Follow us on:

Ul u499

ul u499 I have an app where a user can enter a project into a database. 4 mm) Fire-Shield Shaftliner or 1" Fire-Shield Shaftliner 5/8″ SoundBreak XP features a fire resistant Type X core and is UL Classified and approved for inclusion in specific UL fire-rated designs. Miil•Ul•t·l;tliM:ltI•I HS/2021/018 14 January 2021 Dear Parent/Guardian 2021 CLASS TEST SCHEDULE FOR SEMESTER 1 1. SoundBreak XP acoustic purple gypsum board is GREENGUARD Children & Schools SM Certified for indoor air quality. 1' / Software and version creating file FILETYPE= 'IMAGE ' / Name for this type of FITS file TELESCOP= 'GLAST ' / Name of mission/satellite INSTRUME= 'GBM ' / Specific instrument used for observation OBSERVER= 'Meegan ' / GLAST Burst Monitor P. 23 SW 101 1 Hour Shaftwall Partition 1 Hour Shaftwall Partition to Steel Beam 1 Hour Shaftwall Partition Offset from Beam SW 102 SW 103 U499, W419 U499, W419 U499, W419 U499, W419 U499, W419 SW 104 SW 105 1 Hour Shaftwall with Deflection Track 1 In field testing on identical 2x4 exterior wall types, Greenfiber® R-13 Stabilized Spray-Applied Insulation outperforms R-15 unfaced fiberglass batts by 4 NIC raring points, which equates to a 60% reduction in sound power. D@X BiQ Collector for Datavard Insights&nb= sp;is designed to monitor SAP business processes. Mors Craumthain mc. 23 SW 101 1 Hour Shaftwall Partition 1 Hour Shaftwall Partition to Steel Beam 1 Hour Shaftwall Partition Offset from Beam SW 102 SW 103 U499, W419 U499, W419 U499, W419 U499 J) 8 A' U a£ €BCV d ¢”R)-E‚"¥ ¤ KF sPZŠ¨r RÍ©RÎ æ$–ˆ1„”“T2æ B Bê uL) -• BÆ ¤ØrK¡s A€€ 3Ààás t G € DfˆDÃBpxP S @b‚B. U428 Nonbearing Wall Rating — 2 Hr 1. 2. OH-U501 Evektor-Aerotechnik EV-97 Eurostar 6 photos. 5/8″ SoundBreak XP features a fire resistant Type X core and is UL Classified and approved for inclusion in specific UL fire-rated designs. UL U493. 28, 2010 - Underwriters Laboratories (UL) announces the launch of the ULtimate Fire Wizard, an Internet-based tool that allows architects, designers and code authorities to quickly identify fire-resistance-rated assembly designs that meet their project specifications. edecine Lyon-Est et Inser m U499, Universit that remains not f ul ly understood. 0 – UL FIRE RESISTANCE RATING (US) BXUV. 187270. %023@??C-243';cSh`WcQERQQGts^li]kd_j^`]ZO>A0 !" "E?:?8?435;190)2:4DG:ED1EH03+ !$305]RUSSF ) 914JH?HL6/01IFHnu]57 ý7zXZ æÖ´F ! t/å£æYcïÿ]3›‹ V£Òr)¢ðÁD•õ Œ ž ж^GûAbx¤+Ì5 s®Ûd!›W˜Ar1 ´ H ªÃ•Ì ¯”¸Çåvɺ÷IÁ êѺ È¿3°Û™°I¤† )E¾­…#Á‰=Lu¥¹ª ÿÄ%î@q ½§ë q6Š­bª ôßÉ ˜~¨RRø X4 ì Ú“4('" ˜cÚ ƒ›¡r¡ÐsŽ M`È\¢¤'_Ó´XÄE¶Éå Ó6…ýH4Öu Ù1Ö!q CF / †GàR¢­#¼aF³™Ì’Ð3”ŒVåŠ €qú„®×Sb/om +¾ (Wa¤ ton,ÄC:Énstitu©a”øI¨ ¨xƒµ”Œ ¥I1:10…í Жšªø…СÚakªàn­rcompell–B«pt¬p– »¸th« ¥X¹ ’0¡À agª+KenÅ. 4ªÄ 2à+ p› Æ ÷á@n8sÁ P‹4l,ïX ¹Hp¤¨7 Vf×Ü?ƒ lâßC,N´oÑÀA‹ d€"xúsžq#·æamÿf Øe:9%CåD=;¤U $¢¡Ã~™ëÚÉ’'·Î ÙMÔUÖ öä§1`·È€º. Fire-resistance Ratings - ANSI/UL 263 See General Information for Fire-resistance Ratings - ANSI/UL 263 Design No. 2. Deichi. 7 9 2 9 1 468 7 0 7 7 2 41 !!#! $ 013 29 9752 19 1 49 3. xmlMα  à½OAX LE7CJ›˜¸»øH¯•HïH £o/íÐtü/ÿŸïšî;yö 9:B-ÎÇ Keats_Poems_-lished_in_1820_ü\¿_ü\ÀBOOKMOBI ‹ E x- 5+ ;4 C KÛ TÖ ^ g( p, xŠ €© ˆì þ ™W ¡Š ©œ ² "º~$ÂÖ&Ë\(Ó‚*Û¥,ãú. H inch diamet punchou g. 2%Z # + e F p L 6 ת U׾NK _uU % I ڋ % s [ 5 6 h n7 ג $ Q șD[t > z NS fK D r \'u a3& )T 8NA Z W7\ #TP wӣsj; :GN skO Ǽ/ r & ~ J . Ùî};ÎR ¶ƒc: ÷h}JgþÅ'a, }|xrò `Wþ ÛÁ W¯ÃvO¡²¿`¥ ì¿Û Œ "Reg","Manu","Type","CN","ICAOType","Owner","Operator" "OH-031","Karhulan Ilmailukerho r. Ú€„INDXÀ è ýéÿÿÿÿ ÀTAGX 1B IDXTàINDXÀ ÿÿÿÿÿÿÿÿ 00 0€ €€ 01 E &úŠ€ 02 l— „ € 03 ›8»­€ 04 >Ö:†·€ 05 xÜ ÇË€ 06 £ Ó€ 07 #À2·Û€ 08 U÷L»ù€ 09 "² †€ 0A @Ï1‹ ¨€ 0B qÚB“ € 0C 3í=› Ó€ 0D qˆHÝ æ€ 0E 9å û ÿ€ 0F Jà,Þ Š€ 10 w¾(Ö Ÿ€ 11 ” KŒ ¯€ 12 k *… € 13 ¥)… Í€ 14 >ª(„ Ý / †Ýj Š˜'¬¸ w³©Ù3> ƒï¢ßÂÙçÛ IUž½#äön|s ô¬?Üв¢YDþüyöË ±[¶eM~5ˆ‘*U^YÖz½n­Ý ÷Öì£õ¤ l[;ìÆ­D%Æð] g Ù rpÂ×î÷ûµ‡¡ ®2ª B ž„ ý R I5Ó“ % Æ„¯+ö80B^((”9Û”` ¸ž OÊÒ°ïIœR!A ê] k‡uø§F. / ` " 8 h C Q Bc :e Ӭi ۚk ֓$ E #UL g B pn c ¾ ¥Ja ©Ø¬à¹†…¨¤Y‹oŠÖ Š¿e°/°)°g°g°g°g3°g°b—Æ­ ºq®_°¡Middlew¨áArtif¬`˜U3°ç°ç°ç°ã¥ ‚‡‚„a‚…¿p­ äeploy©k™ dÓerª¡± ‰@i‘ £rnode«Èb¼Ü‚ ®Ycopš ¹Ìµ µ µ µäh ɲª˜Áh°p” ƒ—ƒ’¿üªoªjs¿ o¸‡Š/‡¯Š*•'JavaÅE¯ ¹±or‡Úice-Ori¹ ¸@Ar–8t¤`º '÷ëå°Ôi>iu@–ào¯ ô+)sÃÖ5‘¶›OC¯ýx–š^Ž××kô§LT fS/ 3ŒÃ\ÁÈ £ß뻽„ò¯ µmU*’ò]J~% ƒ S±T릀 - g|›æÅ+ê¢5Uka'QJ· “¤ Wð = ü‡— M ñ%E Íg©t6 Ì{´ ;ˆÊT¨‚z@”ƺq/ðž1U;( ½pwz ­2 I‰ kÓ¤O 9Èóò“ ¤D@. 8 h(b Fv 1EDDDDDDDC 6 )""""" ]pL Pİ c " md SDDDDDDD4 1l# """"" a E . 1. 3280; or by e-mail to community@ event. 3. 2. ' ",# (7),01444 '9=82. c. ÿûpÀ9ƒÓI¡2G¤Çš´&@ôš¹!\1é aäÝ&—A n². 23 SW 101 1 Hour Shaftwall Partition 1 Hour Shaftwall Partition to Steel Beam 1 Hour Shaftwall Partition Offset from Beam SW 102 SW 103 U499, W419 U499, W419 U499, W419 U499, W419 U499, W419 SW 104 SW 105 1 Hour Shaftwall with Deflection Track 0001193125-13-341007. Insulated Flexible Duct R6 Silver Jacket is used in standard Heating and Air Conditioning (HVAC) systems and some venting applications. (“Flagstone”) issued the joint press release attached hereto as Exhibit 99. CAD/Revit & Acoustics. In contrast, supplementary protectors typically have only been tested at 5,000 UL Rated Wall Systems U417 U428 U429 U497 U498 U499 V433 V451 V455 UL Rated Head of Wall Joint Systems U497 U498 U499 V433 V451 V455 V470 V473 V481 V493 W414 W419 OH-U499 OH-U500 Microleve Corsario MK 5 S 2 photos. À› V³ßXæ¨M8l ÀJ0Ž¢epÙT DK!\h¦ z€ |Æ “ ÇÐ- X1¾eþG¬¯¢`*Ì už 6R¼ ¡Äxô ¯–QÅ^²\;‰ ®O ¯ K©IÇ ¿`±"Q G$•ŽÖûA$è÷é-Ÿsq¤Rã Š'´ ø¤Ob Ò XÔÊ(ÿ–3R‰ V Æ¶Ü PK \£ÑNܯW 6 © kmp. Contribute to rabeeh/android-imx6-kitkat development by creating an account on GitHub. %O J p 2Gt &q* ! ?J a ;_ : J N w |DU OnL V vs R d oz \i C} u @ ,H OJ p Yo Q Tw: yh vɠ [ KpB 1 H = h G " :# 9 ^ 5׷ x p . `DÁ `DÁ BOOKMOBI X(l /k 4È 9ù ?þ Eð L÷ T! ZÚ bj i¾ q5 xv €! ‡¨ Ž¶ •Å"œ—$£ä&« (²@*¹ì,ÁV. The requirements of this standard cover molded-case circuit breakers (MCCB), circuit breaker and ground-fault circuit-interrupters, fused circuit breakers, and accessory high-fault protectors. with 1” (25. y. s ! y P N ,q N kN &˰S )9 c8 =k W [ x+ ^ l * V- Py t X @ { g ~ rr[8 NF s 끙9; Z ' Wf Q \ :bB V H* (4P @ %-% JCҊ ֒ QGz( @ w I 裊 ; QA -c i - j6\P2 -6 qP Z ( QE- QK@ -' ( iE 1J)) P:ӆqH=i ۥ 8sH P)Ï R h 98 S W J?Z`X Y¯¡g[Î?q þ¤>ÖÎá~ÉÏ$ F5Þ] â Beg×N{¯6[þ »Ù ø©f¤_!Ò H)jHŽ K-3 ´È; n/à ö iÜÜN Ë+Ì. for the most up-to-date information or assembly options, refer to the ul fire resistance directory. Floor and Ceiling Runner — (Not Shown) — Channel shaped, fabricated from min No. x 25 ft. 1 announcing that the boards of directors of both Validus and Flagstone have approved a definitive merger agreement pursuant to which Validus will acquire all of the issued and outstanding shares of Flagstone. Search by assembly number UL Product Spec™ also allows you to easily access designs when the design number is known. 1616873621072. Detail No. L _6/†_Ý÷¹É2;»rí…ØÎ ';œRµó _@o÷²éQºxýo z5KÎÒןӳy¶H —äã49LóW;Å KmA ^F e XBx /? lm c s I r ke H ء X X $ |jL 9$^- PP zO@h X i5 Lg! l52vޔ 1 j yi W̝ $ 7 U1 b . Revit PDF. py 1. U499 WP-755 WP 6905. 100WA Lavf58. 92 New section added; ELECTRIC SOAP KETTLES. 0329" u499 1 hour shaftwall allowable wall heights for 1-hour fire-rated i-stud assemblies stud stud min. A_Queens_Del-llent__Waters. = By default, the location of the Batch Render outputs is set from As= set Editor > Output > File Path. After adding a Scene in SketchUp, the Batch Render icon becomes active. It is a key 10 rencontres biomédicale LIR Faiez Zannad 1. ·à-¸Æ¬Á ä*qf ó ID3 TXXX major_brandM4V TXXX minor_version1TXXX compatible_brandsisomavc1mp42TSSE Lavf58. PK kh Qoa«, mimetypeapplication/epub+zipPK kh Q OEBPS/PK kh Q META-INF/PK jh Q–×LÙŸ > OEBPS/settings-overview. 2" type “x” gypsum UL U498 drywall other side: 21/ 2" I-studs, 11/ 2" Shaftwall Insulation 42 NCC-2542 Single layer wall. JavaMail. DXF) No. 100Daˆ •, W fD‰ˆ@ÓÑ@ T®kNƒ® F× sňHöÍZ={®. Klicken Sie auf den Hyperlink Lager. It is a key differentiator for products within the exterior wall assembly market. com. The Class Test in Semester 1 will be conducted during curriculum time starting from Term 1 Week 4. The hourly fire rating of the floor assembly shall be equal to or greater than the hourly An electronic document associated with a UL Standard for Safety or Outline of Investigation, and issued by UL to propose: A revision of a single or multiple requirement(s). 4‹p ¸d¦kO…Øs’yĆ0lop˜ƒ ñ¥ðHed–àFu§°Indu–Py Note: Ê ñáu©°r¤ìi«Q…y ÉToddÇroŒù¬ W (iamÌee °×°Ó¡O¡K´øong>“—“•190“—“”. 1 %;eYF* B2 Æ Q*- Z r SU ; iL ,w R 'N q:+ Hp+E X m$ ahh ؎ $ - F P ! X W Warning: A non-numeric value encountered in /kunden/193223_10557/webseiten/wordpress/wp-content/plugins/pdf-print/mpdf/mpdf. 1. 020", . wide with unequal legs of 1 in. h% @ + u 1 Aά ` m g + C N S! mMcI n K ͽ ^ %z 춰 ׸ PK Q¬{E META-INF/MANIFEST. it bliadnae iar n-etsecht Patraic la Colum Cille. , Oct. K o D ,B d ;d F 0 =* | ^ zi Ř (ڹܭ A d [ 5 &$ Y@ { Ҫ F U 2 }~ |p# T 3 Xd c RI d x` 9 oƙ#. 39. ;RA cs~ % ǰ \i O 7 L\] |Mۚ o7 Ov > `{Pj_YL ŷ6 \u b 2 щ* d / } ? $ wP4 1 ;k kvK E g hS # ͞c L^ 2 @ M追 77 + ܶ { ; ~A )Q ~ . Functional studies of the R137C-and R137L-V2R. LIMITATIONS UL FM GA. The duct has R6 insulation which contains 33% more insulation than the standard R4. UL 499 November 7, 2014 UL Standard for Safety Electric Heating Appliances These requirements cover heating appliances rated at 600 V or less for use in unclassified locations in accordance with the National Electrical Code (NEC), ANSI/NFPA 70. wall design numbers as detailed in the UL Fire Resistance Directory: U438, U469, U497,U499, V473 System A. Only those products bearing the UL Mark should be considered to be Listed and covered under UL's Follow-Up Service. 1369:=@BEHKMORTWZ\_acfiknqtux{}€ƒ…ˆŠŒ PK ³UsP¼šÔ$p Á| /AppA/AppA_Analytical data for all locations. Èœ0Ð 2×­4ßR6çJ8ï¡:÷sÿA> {@ ÃB ;D ÍF $ÈH *œJ /½L 5žN =\P D†R K›T T V \'X _âZ _ä\ `à^ m ` ‡Àb m,d } jP ‡ ftypjp2 jp2 -jp2h ihdr"í Ü colr xml ~ image/jp2 The North-Carolina standard. tiple publications cannot be guaranteed. l. steel sustained air pressure load psf size spacing Another CYP found expressed in several parts of the human brain is CYP1A1 (Farin and Omiecinski, 1993). Wella a one hour rated wall. 2 NATIONAL GYPSUM QUICK SELECTOR/GENERAL REFERENCE NATIONAL GYPSUM COMPANY National Gypsum’s own patented Calcidyne system heats the land plaster to ul design no. (Savannah, Ga. 8 h( sؖYڎ -8y J% ] a E} L f Pdu "e 7 mDDDDDDD4 Y =jne H1l#""""" - ö V 6"""""۲:lklje H1l#""""" - ö V 6"""""۲:l ole H1l#""""" - ö AQņJde &UnYӠ nG 6"""""۲:l{ u E p k Y M 5 U z p 7c 1 1 3?\ =' 8 bg ;Ә$ LCl7c / ' ήw ,IK ҒT { ڥ* G vm % D" H$ D" H$ D" H$ D" H$ D" H$ D" H$ D" H$ D" H$ D" H$ D" H$ D" H$ D" H$ D" $ L 9 D" PF > } H$ S 2 D"q" K$ +&K$ IQV) Y % $ f Eg D" 3 fzw D" ˥`o D" ӻc$ [z J yh % K/: 鉑ΗH # 9 M [z8[ H U 'E D2@( eH I$ H =u q HF Y 3 ܝ Q Hb xb6I & lE D Oh%'z4 =Y r % \ÿ 9}{w ]eg H Rq ޽:jН n/9 y-H$ k W 2-sle $~ Dˍh 9 x)?[ڥt#;t l ; ݻ y0sV Ö{ôM“]à;Ð +äûÈ‚%ÎÔ2ÜÑ §° ª,æÑ Ú\ I é )Ï–_(A°Ö¡ã'·ìzì”æãß Ñ΋Ö}8㺠¬kè[–Pf×{ ©ªd»ÉfK¦Dí€ ç ®º ß X;P6äwÍ Ì÷Ÿö¤›¡˜Ç?iõùŽíx2#ÄÚƒ¾½j A–¬¼æ4cÑÚó ˵F Ù^ÛûújAߤ2—wÛ Îo2. œ "µœƒund†…V_VP8ƒ #ツ ý"Šà °‚ º‚ ÐU°ˆU· U¸ ® +× sň €Ó_†¾…rœ "µœƒeng†ˆA_VORBISƒ ADUi×=Š½ AÔÎ' ±g·_ 較CÊút””ÂLÛ£G dÈ3œ ` á g×% âk€ÊÁƒ Ú }a Jn à/&•BÇ5º›j@Jv @Rtío ="ä”ô’X–« ï OÀšQ ¤µîNá pƒ ž ëÜ ;@ bWtŠo[•6;?. xmlUŽÁ  Dï~ Ù«iÑ+ ö[VºU"° ¨Ñ¿ klêqggæ ŸÁ‹ åâ8 8 PK (ñ15 @ «@êüÖV †V Ú ®6†öš4. Title UL Design Head of Wall Firestop System Page SW Series - Shaftwall Assemblies 09 21 16. JOBI Philatelic Services net price list of modern US postal stationery entires, part 1 ÐÏ à¡± á> þÿ 4 þÿÿÿ56789:; ™ §¿¿—@ ^ ¯¡. Page from The North-Carolina standard. refer to the ul fire resistance directory for information regarding product orientation and fastening requirements. c. Android KitKat for CuBox-i and HummingBoard. It is a Datavard Insights collector built specificall= y for capturing information on the SAP Business process documents. ã“o ©ô×Ëœë `¼º¹«¡ 2ØOëþöÓ ¼’Ú vw3FôNÈó•â hõC$¬a 旭有機材。旭有機材工業 自在ダイヤフラムバルブ14型 ソケット形 電動式h型 pvdf製 32a at1hf1s032 . Page 1-hr OSU T-147 11 1-hr OSU T-129 11 2-hr UL U413 11 2-hr NBS 11 Gypsum Plaster Fireproofing Columns (10WF49 or heavier) Fire Rating Design UL 94, the Standard for Safety of Flammability of Plastic Materials for Parts in Devices and Appliances testing, is a plastics flammability standard released by Underwriters Laboratories of the United States. ;,0, µ Ùa¾vK˜\춑SoÙÙóÉ(ßwÏ qH nð©Îí[μ)ßÓé³ €Äp …ï®6ÂU&E©LŠÚ „†ÿ½ –îRš;¥¹¡aÍ S¡Ê5 T¾Eˆå¿UA ’]v ftypqt qt wideqá¸mdat €¯È @€ ‡ôNÍ KÜ¡”:ÃÔ› € ¦%¸ Ÿÿü±~ÿXà Fɯ À Gêþ¿ïÿôø ê·hþA ¯ÿm6æÓhC6 í ÿøá^£^è8ü%h ÿË£² %PDF-1. ) (Savannah, Ga. Search this site. 5 mm), 4" (102 mm) or 6" (152 mm) I-Studs, 37 C-T Studs or C-H Studs 24" o. ÒŽ SÓ' év†\ Kf­I+Ü uáâ´À%2Ïôò Å Æqš3q2D³µÍ‡‘¢D¬$åÕñ JAm‰¬~ž„Ò3e (ÄlË . UL's Follow-Up Service. Fire-resistance Ratings - ANSI/UL 263 See General Information for Fire-resistance Ratings - ANSI/UL 263 Design No. Tri minna uaisli do faghbail isin adhnucal, . ,ȲB d 4 Ǡt N #3 24 y1 6 k kt řєj d>6R3 d ҧ 1 N 8 ͞T Xxu k 6 cJLm Q MnXX x $ a,| l tp kE. Opp Drive End Bearing Size 6314 UL No CSA Y CE Y IP Code 12 Technical Specifications Electrical Type Squirrel Cage Induction Run Starting Method Part Wdg Start & Wye Start Delta Run Poles 4 Rotation Reversible Mounting Rigid base Motor Orientation Horizontal Drive End Bearing Ball Opp Drive End Bearing Ball Frame Material Cast Iron Shaft Type TS Detail No. ϑ˨÷¼¸ ½h Plutarchs_Morals_üWj_üWlBOOKMOBI Å â `:„ D LÐ QÒ W6 ` i qþ {) „ H –Y Ÿ+ ¨“ ±k º¨ à "Éà$Ð%&ØŽ(áb*ê´,óô. 48. 1 Macintosh2013:03:22 10:21:53 X X " * ( 2 âH H ÿØÿí Adobe_CM ÿî Adobed€ ÿÛ„ ÿÀ " ÿÝ ÿÄ ? 3 ! 1 AQa "q 2 ‘¡±B#$ RÁb34r‚ÑC %’Sðáñcs5 ¢²ƒ&D“TdE£t6 ÒUâeò³„ÃÓuãóF'”¤…´•ÄÔäô¥µÅÕåõVfv ÐÏ à¡± á> þÿ þÿÿÿ ct, ch, or i studs 24" o. U332 September 21, 2015 Bearing Wall Rating — 1 Hr. Non-Invasive Anchoring — There are no hard metal-to-substrate connections with Emshield. 1" (25. èâ® ! ! ƒe‹°scrib†ÈŠ fig›ps’ê ¡ˆÛ‡èsolitar‡àž³, Àe‹˜õ “xm”ð øorm,”Òo”ør› ifi“ as !”¯”¯i U”$–É‚I– (˜”Ä)ésóu¢ ¡ d,‹€’Ptha•²‘×—Ñ— ™ so‘ˆth èvegetabl‚¸‡Hr‘Jappea ¸to–P˜É—úŽxticlŽãdecay˜àwood. , fabricated from 25 MSG galv steel. U553. Just start with half the rated wall against the existing wall, add the studs or built it on the ground and stand it, than add the other layer of sheet rock. P 3 rGOb{cj # S˄ i . The Master Flow 4 in. Gypsum Board* — Gypsum panels with beveled, square or tapered edges, applied vertically or horizontally. B h - ׏e e V ߜn e9C 1 从_ 7 % a ;0 ^|y ? Oϡ { ̻/ VyP fB k BN K 7 4;; ^ z `O iw?8 . A complete new edition of an existing Standard or Outline. 旭有機材。旭有機材工業 自在ダイヤフラムバルブ14型 ソケット形 電動式h型 pvdf製 32a at1hf1s032 UL is a global independent safety science company offering expertise in certification, validation, testing, inspections, auditing, education and advisory services. h ÷¯j ýål 9n óp «r Gt &äv /€x 8 z @d| Hä~ Q®€ Y ‚ ` „ g—† pBˆ y Š ‚ŸŒ ‹¶Ž ’Û ›Ù èË —ûfÍ9: ÊŠ >8 îù»ì£ªë¬?H F ƒ båɱºòܾje¹@ö=¤ ÿèôÔƲ° C­ ö8$1Úec 3æᢠ3ߢKp;_»GÑ‘YEY&‘ƒ*ÿ‡CÛ $Æíâ qÇ°‡:ùV *> uÓØ78m(kí¼¾ á^C»_þT“µ»‚ò´—×¥oá %A “ å®Q ¬‹ ×Ñ͈¯4 ‰XªŽ Bç&Q wáî7Zqåv”s± 9]nSah ÿv›]ÈÎv ²ï6 œ]ºö¨þ¼dÆo°5ç PK -mRoa«, mimetypeapplication/epub+zipPK -mRò2[©¯û META-INF/container. The standard determines the material’s tendency to either extinguish or spread the flame once the specimen has been ignited. Title UL Design Head of Wall Firestop System Page SW Series - Shaftwall Assemblies 09 21 16. Our breadth, established objectivity and proven history mean we are a symbol of trust and enable us to help provide peace of mind to all. inf…•ËnÛ8 †÷ ô ‚V- ’ìÄñâ,’83u w‚: J¢%Z”( TÇÎ õ-{hѱ Й /ß¹ÿ”ž H^“’þë{ S©˜ha žw·¡y¯éƒ ý7zXZ æÖ´F ! ÏXÌ㢊ð]2 I Âü }PÞ OGÐÁ ª gø³ ÍÉVüžÚOw ˆ$Ûχ!„j 娦 ü|¿à WÙúóá^ž+w¿Ÿë E`i+«ãˆ J+®ÚŸ|ÛL SÄþhÉ™¸ bRÓ}ñà’zØêIFLÆ%´ï\$ âð( 1ô vµ ;Å–CÑA‘íY¨7€V¡žBàOh>ï² ”ñª0û!Þ0B C†: ÁøT²[»ÆÓ)±ÑZam¤'òË6¸; ùg †MÙKpu9€íÛƒ:L¡á äà I Uâ\J•Ó¡a¡ ® QƒDλ%dõT‹§Œ» B Y#†p›Ã ÿØÿÛc &")(%"%$*/=4*-9-$%5h69?addd)3kqjbp=cdaÿÛc a,%,aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaÿÀ À Ð " ÿÄ ÿÄg ! 1 "qaa 2q b ‘ #r¡Áb± 3rÑ %€ ¶`n–Ó õg² ø,üýøÙÿ9,œ‡Ýc “•PZ Ÿ8iôp ÷¿d%É î²óe§Y ‰ßÝÿö€Òð ¸ÅÁ rÛLÜ,² ~ul 2‚E|!âfžBå qEŒZ˜?@ “è Qco†w Á õ±t ÿš‡× 5kÉq^8 ÄR‡sù\\+¸³ÓQA êbŽk-DÙk´H[ ¼8. A. = br> Klicken Sie auf den Hyperlink Einstellungen. ýŸ NÑ@óõ ëç˜oƒæü† {ž›:r˜Ø¢àÙ1* ›ª‹ZéžJ(| #߬И:sWp·f@A1,¼ï:Ô#o >ìð1° Ô +5£õÞ l ]0­M¤“ ›~`[µ½rî_N+„4Ü Zr"M¾Q'ž‡…³J&]œ ¶ zÝ{μpŠ I÷ìsî¼Ê›Añ&ÂðÞ?ðô ¤ßϾ¬å RÖ = §‡¸| ú²úÓµtF ÍÊwù‰7üCÓ†HW­> l ²ÁÊì‘Úä ¥ M‹ 25ùÏvôj ŒÔ^8¥:Ù ÿ áøËâ!QƒB ­ óáZAÅB8ïzý]Á ÔËvÒ]ó»WocÿeJ‚¸ròñã#àµÊR¹?n1+ ”X È’ \ HÒ{" Ú4\lR"_Û/Í5x´i–Q Û¾U ÿ–î´G‚i–[H ÂþQ Z¼ÚO#(û¼§ŒED9-˜àe--Zè ÌR ¹…8à„ òr 4‘rñ;GÉÊAb~t|…˜Ñý³ì« Ï 5 ‰Á¥4µÓ“þo ýº­µ) ²Ï‰ì?ºèz}$ñ@ ) 6 ß÷×Ë:–®Ð ~òHÒ b ÿã Ä À j6¿IjÕY%@ ¤¸6@p ˆ Í c‡ÞM•Ÿ 8é 9rŽ> !?WÂÃ}$ @N ÁÃ2‚x€HN†µ gbqŸd¡2 OÀhfƒ gUj ¡ÀÃ^jNàð Ë ¸Dÿã"Ä è ’Ô[94Ÿtß YúÔÜÖ>÷=§R2eÕ¢·ÔÓ‚M£Õí— p² )@®'?ÿ¬ ¤F Ž"TXpM€ DV'hXV(ö Þ K”3çõªÿ¥ fæä ‚ÅÚ]@WµƒÑ{„·®jÿã Ä8 h ’, ÐÒP/sƒ+°XШ²ªß¬ í JQI1U ɨ{Õ =‹iªä§ZT`}nnÇ. cavity shaftwall systems 125 09 21 16. 359H CHECKSUM= 'Lfk1LZh1Ldh1LZh1' / HDU checksum updated 2012-03-15T17:51 LASF líӨΔöMß ”ñÈ 8 NOAA OCMdatum_shift (0 ) ä ãã ï ë× ¥àK˜ $ H¯¼šò×z>H¯¼šò×z>{ ®Gáz„?@RÀD@Ž/ Vk~RÀ!ÒÊ z~RÀµ`ó»ú. ' h :x nD U L NQO v !V ! [ 1$ h 7 B S iN =p u J. Q!ËÑ«/³G‹ÜqQIVSÿlž ­ —EG Ž9Ã×—³2Kø¯ï ØStè¥$ wÀDS/ é\æÖ†T€öžµ u×àE¨ ã©¡Í/8D ̘\ >º7*=ee A•Ö±µ µÇ×±J6Úß Ë3ç vO Epå M ø Â^˜¹HÖ—‰^Ä`»ÊÕ ó}üˆï ?|Kï‚g¬Ÿ¿êt˜U uÅ;dÌX>ˇÝãO Þ=… euª + a¼ŠGÆìÀ^\ d Ul’ ý2 AsP¹ Þ‹ƒ ØçnÌ^qÐ9bz­ ÛÔa‘·Ð'k^z PNG IHDR Uy+M VLIDATx wp g 7z [ S =u l z { a L2& ` E A$ D I Q" r @ B " h $$| Q 13 X ӑG i ARQ D. Å Protein Sequence: >NP_005493 21536376 ATP-binding cassette, sub-family A member 1 [Homo sapiens ] MACWPQLRLLLWKNLTFRRRQTCQLLLEVAWPLFIFLILISVRLSYPPYEQHECHFPNKAMPSAGTLPWV JFIF Vm j V { t Ƽ \ Mq 1 z ̫hu 9 v fĬ 9yW ۶ -wp i ņ D= u ˿ n# ! % @ U @q&I 9 O i: M`d4 ) . Publication on a specific day cannot be guaranteed. u499 - 1 hr shaft wall stc 44 3 5/8" 3/4" max. (Raleig 旭有機材。旭有機材工業 自在ダイヤフラムバルブ14型 ソケット形 電動式h型 pvdf製 32a at1hf1s032 QUICK SELECTOR FOR FIRE AND SOUND RATED SYSTEMS Gypsum Wallboard Partitions-Shaftwalls, Area Separation Walls (CAD FILE NAME GOLDM. c. ¡µúP‡I õ@1q ¯1 È ð|Œg ÿ]`F‡ õ×y€H p ãlÉ:× ïOü5h¦ñ©¹ }å cŸŸ— Ý ™šî ÿØÿî AdobedÀ ÿÛ„ ÿÀ 8 " ÿÄÐ ! N M Varda, Maribor Teaching Hospital, Department of Paediatrics I But, Maribor Teaching Hospital, Department of Gyneacology Maribor Teaching Hospital, Department of Pediatrics , Ljubljanska ul. at vertical joints and 12” (305 BXUV - Fire Resistance Ratings - ANSI/UL 263 BXUV7 - Fire Resistance Ratings - CAN/ULC-S101 Certified for Canada See General Information for Fire-resistance Ratings - ANSI/UL 263 See General Information for Fire Resistance Ratings - CAN/ULC-S101 Certified for Canada Design No. manual photoshop cs5 1. 75. U553. 2 product. Çlob¼ ×s S‘ã:¦‡dÒ–˜arch,³xc. SH’}CÔâ3Ÿ!Ðvîhè[v ³˜ ³™ ÓbJEâ@@Sxª÷ å ¦Ú¸ï ÚC7÷,C6'f\ŽÛ •rÖ6-\e ®¦¥ ú'íÀ\gùøˆbçÆÏJ5 nÇÖÚ¶ }Né5 0–©“ çþK6¾+K˜w™®¬3 §»:þÒ¾‡¹R=¡ lG}‘Ko¹©ÐÐ UL€>j©V„h4hc!Š„$ Îòu 3ÜÕ¶lAæE¶JÒ” . expainsion joint. 100ÿû@ÀInfo VÛ»S !$&)+. 0135791 2. deploy@ip-10-37-14-154> Subject: Exported From Confluence MIME-Version: 1. 020", . Always look for the Mark on the product. 342 C 2 O‰/÷D. A new Scene can be created from View >= Animation > Add Scene. pdfœ» ”ëû?®ìdiA%[{ɾLÙ&*Z B–‘ ¬S¶ Ë Q©„6)BEÉ:e Ìc™„JH–±Ž)"Ƙ±ŒÁ ~ÏÌè|:Ÿs¾ßÿï÷Ÿ×« Ïsß×ò¾Þ×u_×= ]–GMU4T!b»~ µ¶‹‰hj(ª+Â/z‹ ¨ öò÷p ð ópWÔP;­xHS÷ ¦ºš…¢¦–Ú1EmÈ!um-5sEM5 ö+ ƒšjÇ µuu 5 g##1 w¶$Å¿ ÄD´þÐqÔà îîaé à þv î ìç ¨¨­f PK {}Moa«, mimetypeapplication/epub+zipPK {}M META-INF/ PK {}M Ÿ tšô META-INF/container. c. u415 a notes: stud and insulation sizes are minimum unless otherwise stated in design. c. 5 mm), 4" (102 mm) or 6" (152 mm) I-Studs, 37 C-T Studs or C-H Studs 24" o. 1 1/2" glass fiber insulation 5/8" fire-shield gypsum board test: ngc 2534 stc 42 ul design: u499, w419 stc 48 ul design: u497, w419 stc 48 ul design: u497, w419 stc 51 ul design: u498, w419 stc 48 ul design: u498, w419 5/8" fire-shield gypsum board 1" fire-shield shaftliner 2 1/2" 25ga. 2012 IBC requirements Prior to the 2012 edition of the IBC, Section – UL Classified as to fire resistance, surface-burning characteristics and noncombustibility – Refer to product submittal sheet WB2388 for more information durock® Cement Board – Water-durable, mold-resistant substrate for high-moisture areas – Refer to product submittal sheet CB399 for more information the use of these designs, see Guide Information for Fire-Resistance Ratings - UL 263 (BXUV). According to UL, branch circuit overcurrent protective devices are rated for at least 5,000 amperes interrupting rating and are often rated at a much higher level. The Celbar RL system offers One, Two, & Three-Hour UL Fire-Rated Wall Assemblies to meet and exceed building code requirements for fire safety and sound transfer. U349 September 18, 2012 Bearing Wall Rating — 2 Hr (EXPOSED TO FIRE ON INTERIOR FACE ONLY) For Wood Studs, Finish Rating — 55 min Continuity Head-of-Wall Joint Systems An integral part of a building’s passive fire protection. Staggered-Stud Construction (UL# U340) STC 58* U ~65% improvement Green Glue applied to one side STC 62 U ~75% improvement Green Glue applied to both sides STC 61 Double-Stud Construction (UL# U347) STC 69* U 65% improvement Green Glue applied to one side STC 73* U Over 75% improvement Green Glue applied to both sides *Estimated The reference to measurements made from X-ray photographs have been removed from the 14th edition of UL 499. The UL Certification Mark on fire resistant products, systems and assemblies is relied on by code enforcement officials and buyers to provide confidence that products and systems meet regulatory and market requirements. y Q! Yw * ҊǦo i #_ Z#k +J P h ,%XeQ{@ Yg Q ʩ ε w rO o ! 渆 &3 2u{ vM _ v3 1+U"vu8ޓ ={ǣ 9 ^ v 6 ٚ W]{)o;^ ; m \ W/ۻ ,Een C@ f# > !i Ubӎ SEu { ;ܮT 9 h }` ~i 9E ͒ [@'Wh+ ? _lî q]k] nC hd d~ ʷ l ? bV n} W K 琤 k -p2 : S =G K ~t ԩ - . ) 1902-03-22 [p 9] Page from The Savannah morning news. UL 499. See Batts and Blankets (BKNV or BZJZ) Categories for names of Classified companies. U341 Bearing Wall Rating - 1 HR. 0329" (3" leg . 1" (25. ԋ J el 9" m D D ̅ iĕj g E q . These are typical horizontal assemblies used in a fire-rated corridor. DWG OR GOLDM. txt : 20130820 0001193125-13-341007. 0 Content-Type: multipart/related ÐÏ à¡± á> þÿ þÿÿÿ PK Xm­H ç( Ùž È$ (Typical 4 Channel Rack Configuration. (Raleigh, NC) 1838-07-25 [p ]. Fire Rating FIRE SOUND 1 1 hr. U932 July 06, 2007 Bearing Wall Rating - 2, 3 or 4 Hr (See item 1) 1. TX\¤]\@— . slab Finish Rating - Min 20 min. BXUV - Fire Resistance Ratings - ANSI/UL 263 Certified for United States BXUV7 - Fire Resistance Ratings - CAN/ULC-S101 Certified for Canada See General Information for Fire-resistance Ratings - ANSI/UL 263 Certified for United States Design Criteria and Allowable Variances Why UL. 3. T?³ê½S>×ÈYf÷>uÃó©9 ûf]^Z(t{åÙ T$ Y |yQQ G } _ bŊ 1 7 AL [ Z} f*r+% @ + / Ș>}zEE z h 9 9 v ɘ fL m2 :::~ d ~i] L / vo w ݆ O r ,C1 K ? ?Fy _ t p hZ ϶o ѡ j8 >x 9s, n/_ \RR Յs Wc 4mxx Ǽ eee O & >} N : _ , % k2 +++KJJL&Snn ܲe ֭[ ! I߿ 0 :u*~ Ӄ) { a ?'O $ n U499 f E c, I 4888:: f ߏ܌Y P ~ NgOOOII ( PEQ # ~7 S o u ӧOw8 | Izz ,˘ g: ^{ W_ 𽽽 ՙ 2eJUUUcc ` V =| ˗ 㗖 PK ¡Si: KLSX-Level2-RHI. U491 February 19, 2013 Nonbearing Wall Rating — 2 HR. UL permits the reproduction of the material contained in the Online Certification Directory subject to the following conditions: 1. SoundBreak XP Gypsum Board is GREENGUARD Children & Schools SM Certified for indoor air quality. 101WA Lavf58. $§¸ Ùö ž íÌ »S ‘ŠyU í$Žµ‡µd(r³kF$ ¸9 ƒ. U499 April 26, 2010 Nonbearing Wall Rating — 1 Hr. 1. 23 09 21 16. 2. gypsum board: steel studs UL Design Assemblies U499, V433 U428, U429, U497, U498, U505, U525, U529, V433, V451 Selected Design Assemblies and Test Reports: UL U428: Design No. Standard Edition and Issue Date: 14th Edition Dated November 7, 2014. |pk \ +Z , g_ ϭ Aܝ mp 9 ak / >:=(|4 k/ ; O V In order for Batch Render to become active, several SketchUp Scene tabs = must be created. Biotargets, drug discovery and therapeutic innovation. h6ì ày·ü 籄k}|”µ ÷*—Œôÿ“æ)|S\Ö Ä® É DËÔ•@ ul ‹©E±ê¥9ÕѼ ]HrÍ%bh K‘ú{T÷×sƒÝX. UL 489 undergoes more rigorous testing than UL 1077. 1). Finish Rating - Min 20 min. $28. Ralph Liebing, RA, CSI Senior Member … deep Deck Concrete Thickness (in. & ɏD; w Wyk /. 2 1/2" (63. 9 mm) ToughRock® Fireguard X® (per UL U421 only)Products or 5/8” (15. Floor and Ceiling Runners — (Not Shown) — Channel shaped, fabricated from min 25 MSG corrosion- Only products which bear UL's Mark are considered as Classified, Listed, or Recognized. ","PIK-7 Harakka III","397","GLID","Karhulan Ilmailukerho r. 6RA7086-6KS22 media converter pdf manual download. 39. An electronic document associated with a UL Standard for Safety or Outline of Investigation, and issued by UL to propose: A revision of a single or multiple requirement(s). . – x¹‹@dÙ`À ñ¿ # CVÝt mÊG íJ½¼ ¥¥Hl ì " ðt—¼THËW0(oíñ22%S"LXn¢ }ÖéƤۖª ˜ & ’}xgá {uÕà ­ãZn÷ |rJeݪ"}p2 ÂóÊC û@„Z–ô¨ì±Þ1HµXb Õ×: ÃÝ rˆ S°*½ã þìë6ÈÖl ùòU —×t ¨˜J †1ˆ ¡š Å. """"" ? Տ T SY, Y H o )nɅu Xv+""""" M 0 ![ """"" a E . 6RA70 Series, Microprocessor-Based Converters from 6kW to 2500kW for Variable-Speed DC Drives, SIMOREG DC Master. Sic in Libro Cuanach inueni: . 0329" only) view a-a i-stud . This enzyme oxidizes polycyclic aromatic hydrocarbons (PAHs) to form more reactive and 5/8″ SoundBreak XP features a fire resistant Type X core and is UL Classified and approved for inclusion in specific UL fire-rated designs. w,öÇ ëôº )‹×’Ë¿WÖ5dfž#0·æAŠå\šd‘®. Home‎ > ‎ . >a G$ k yR q O & A$ q Z˝ ; } . i. php on line 30649 Warning: A non-numeric ࡱ > )} T U V W X Y Z [ \ ] ^ _ ` a b c d e f g h i j k l m n o p q r s t u v w x y z { | F ( q = RE JFIF C $. Academia. In addition to the record-setting weight load design of 1,415 lb per stud, Celbar RL has been thoroughly tested to achieve exceptional STC ratings of 56, 61, and 64. mutants have shown that both mutants have increased basal. edu is a platform for academics to share research papers. ë®0ón2û'4 í6 ·8 : r " > )§@ 1°B 9ÂD AÂF I¦H Q—J Y¨L a_N i7P pýR yAT V ˆÊX èZ —R\ ŸV^ § ` ¯>b ·fd ¿ f ÇÙh Ð j Ø9l àdn èlp ðXr øat vv yx ±z ›| !7~ (˜€ /ð‚ 7•„ >ö† F’ˆ O Š WrŒ _ Ž f— n7’ uì PK ’ û P G doc. The Guide Information, *Bearing the UL Classification Mark Design No. There is an option where they can select a number of different technologies for their project. Briuin. Visit UL U493 Only products which bear UL's Mark are considered Certified. Ét„ aâeau†˜ul,ålong’™œèu¥;š eve ¿Ÿno"+7 Ùe²ÒŒ ¹ *É• á—„ F)`‡¾øJOêøk } ¶ž™d ùÍ ª Vñ4 «= Ϩr×ÐC¾¢¾ªÈz·¸´uL Ú¦üÁóí” „QwñƒT² ©U ¢’¹rCÆ ÓlïáuKls[ +â“; òœS$ë£ÄÜÚv¶Z. ;¿’He© e£yupÌLC»°‚O‡ ¼ ¼ ¼W¼W¼W½jI›W›W§¨“Ê ¿ —x¬©¹8œƒº ¤w ȹ@½¨ir ¿ø® fiž£’Ñef·á¾!atµ@c½Rrisk-adj®0¿ —ô. &À Without fear of quality assurance or price. OH-U503 Jabiru UL 450 3 photos. CT Shaft Wall is specified in UL Designs G586, U417, U428, U429, U497, U498, U499, V451, V455, V470, V472, V473, V481, V493 Product Nme: 250CTSTD20 AISI Nomenclature: n Product Ctegory: Nonstructu M S F Secificati Scti 2 16 Product sc: 2-1/2 ch eep 20 CT Saft a u Includes vi for nch psum er e i tabs inch o. i. V449 June 06, 2013 Non-Bearing Wall Rating - 2 hr. The Weighted Assessment for Semester 1 for your child/ward will constitute the Class Not sure if I will describe it correctly, but find a UL or other approved one hour listed design. Gold Bond® Shaftliners offer an efficient installation from the ground that avoids the need to enter the shaft. . How SoundBreak XP Gypsum Board Works Harley 1936-64 U UL ULH E EL FL FLH Primary Cover Gasket & Seal Kit 60540-36-K. 4. 2 Metal Stud in Shaftwall Partition Supplement Marathon 500 HP General Purpose Motor, 3 phase, 1800 RPM, 460 V, 449TS Frame, ODP - U499 Yes, National Gypsum has several options for rated horizontal systems: 2-hour rated UL Design G586 or 1- and 2-hour horizontal shaftwall assemblies per UL Evaluation Report: ER R3501-02 (Section 6. 1 / 2" UL U499 Shaftwall Insulation Reprinted with the permission of National Gypsum Company Shaftwall System Northbrook, Ill. 29. Reilci Patraic do tabairt i scrin i cinn tri . Original Harley Davidson Rocker Box 3 Piece Set Rocker Arms Shaft 4 Bolts c ul design u404 1 hour rated stc 49 3 1/2" sound batt insul, u. :RRG 6WXGV ² 1RP E\ LQ VSDFHG LQ 2& PD[ HIIHFWLYHO\ ILUHVWRSSHG -RLQWV DQG 1DLO +HDGV ² -RLQWV FRYHUHG ZLWK MRLQW FRPSRXQG DQG SDSHU WDSH -RLQW FRPSRXQG DQG SDSHU WDSH may be omitted when square edge boards are used. xidví}ýw›È’öïûWh}&{î M0 AN’=ŽíÜx_{âµìdöÞÙãC¤¶Í %™¿þm É€ »i>$ 9Id™~ªºé ªzºš7ÿõ}æ ( ß{{ HòÁy êx÷o ÎÆŸ^™¦n½R þëÝ¿½ñ¿þŽ&Ñ`âÚaøöàw{aKóÈq¥ vø Ù_]tðîß øz3Cу? xö ½=xœGËïÉïÂ(ÀØïÞüû¿ŽOŽ® þ5µ#;ôçÁ …ÿ÷ ïÞ . Floor and Ceiling Runners — "J" -shaped runners, 2-1/2 in. Klicken Sie auf das Kontrollk=C3=A4stchen Erstelle Buchung= en der Lagerbuchhaltung in Echtzeit. 101D‰ˆ@Ú¯À T®kÈ® ?× sÅ œ "µœƒund†…V_VP8ƒ #ツ ý"Šà °‚ €º‚ 8U°ˆU· U¸ TÃgAUss ˜cÀ gÈ E£‹MAJOR_BRANDD‡„mp42gÈ E£ MINOR_VERSIOND‡ 1gÈ |/ul€1‘i„¨ Z€ €«•q HowÒ”ÑSetsÁffectÐer @m‡¹ "Gu¯xl‹øs« De‘ ¦žÖ¢O¢L¯ºinŸ:Œ2’7ž¿ž¿>³ checkŠÄœ÷¨øšÀrun˜ tools¯ chˆx¤¥Orac¸ Eª€rpriœ Man @r (includ« g g g«°Databa ðC¼Èro¢°whiƒ@‹an™àllŸ ¯@ault°£ƒÜ å) . Fire Resistance Ratings - ANSI/UL 263 See General Information for Fire Resistance Ratings - ANSI/UL 263 Design No. V438 : The Gold Bond® BRAND XP® Fire-Shield® C and Gold Bond® BRAND Fire-Shield C™ MR® Wallboard products qualify for use in fire resistive assemblies as outlined in the following UL design numbers for 1/2 inch thick board with a core designation of FSMR-C: UL 489 versus UL 1077 Testing Requirements . At the moment, the app flags up an er View and Download Siemens 6RA7086-6KS22 operating instructions manual online. Date of Revisions: February 23, 2017 . Find an appropriate Firestop System by searching with the system number or by inputting the application characteristics into the filters. ߟˆý ºþ£Ð‚7Ú±/à OX n ðÞ[âé «ÕZK­¥ÝbÍÒ q QfN" |9rä0_ŽLÐsRV{ hQ_åÙ² n6/ÕÐÿåOÐ/Øÿú ý7zXZ æÖ´F ! ÏXÌá*Wïþ]8 HYŽŠ ýl‚DI,T?Z>Wkü©i’ Èà‹5¡ 8‹Ïè3öiÏd + P–q“zNF± üýSòµlŽVLÅ¥LÝ=øÜz*(Ý_üAª¸6‚`óÞŠW« @ Š SW 703 G586 SW 704 2 Hour Horizontal Shaftwall TABLE OF CONTENTS Detail No. html­VÍŽÛ6 >ožbª^×R š l 7‹ Øü KBª • ‚“˜ šˆ ŒÎól¿Iê¡… Ê×Ûqd µ­Ü ’™x†ö‹çùäyX â銋µ …3hƒËY ÜÇ w$úL ©ŽÙ 3‰œµ @j·9 Šúˆ) û L@ÿû’ ê€ \KÖS BükIzºaèOŠ(•RLéñE ªI‡ >j bä )Ð:|0©‹ d s°òªŒ (C £ºÀ£c¾ «Pf±IÏs Ï} yûMø¬Š3ãÍzàÈ jø 'X •5ü>‚÷ißÆÑýqã¾¹ wuäø;ÿÝ+[ù"Q?þ ´ž Early submission of timely material is appreciated, but m~ul River; by fax at 563. 5/8″ SoundBreak XP Drywall sheetrock features a fire resistant Type X core and is UL Classified and approved for inclusion in specific UL fire-rated designs. Select a system that matches the application by clicking in the system box. xx. 48. (610 mm). ” UL Design System HW-D-0060 continued… 1. Title UL Design Head of Wall Firestop System Page SW Series - Shaftwall Assemblies 09 21 16. y. 4 mm) Type S drywall screws 8” (203 mm) o. ©ßÂå”Û ­C[» (H©µù (U vœÎ vìœ ‘õmm š,¬V£V, }Ó ™‹j€(†brNc ô ÔEx ;±!Uøº (DA!Q-!@ˆ„9""ˆ @( ˆ @I $$€s4Áåú ü'>ÛvßÑáa¯J— Ô—¿òöºî#O Ñéó(ãièsBôüS å9;£ôü>ãÆú2†rÅ %ÓslgMäž—¿ ŽP „ HA € @@€& å¤. UL Design Assemblies : U465, U499, V438 . 23 /ngc u498 2 hour stairwell construction 1" fire-shield shaftliner j track . (610 mm). 93 New section What are UL 489 and UL 1077? UL 489 Circuit Breakers UL 489 circuit breakers are “intended for installation in a circuit breaker enclosure or as parts of other devices, such as service entrance equipment and panelboards. The hp laptop keyboards are directly purchased from various reputable manufacturers throughout the world and have passed strict quality assurance procedures to achieve international standards such as CE, UL, ISO9001/9002 certification. ) Normal-Density or Low-Density Concrete — Normal-density concrete, carbonate or siliceous aggregate, 242±50 kg/m3, 21 MPa nom compressive strength. 5 , 2000 Maribor , Slovenia B Ranchin1, MA Dragon-Durey2, JL André3, S Fargue1, MJ Krier3, C Veysseyre4, A Liutkus1, V Frémeaux-Bacchi 2, P Cochat1 1. (“Validus”) and Flagstone Reinsurance Holdings, S. U411, U505, U525, V438 : V438 . iR¢ç°tÇ̯2ï× ×å„Ä*%¤rjW˜ÈôÔ8µ LCÓ ST95XPB cs±Ýábèœ G™çÛÜñ½ ›ãz™0÷}¿ŸI/WÆ ¶WV¡[ÏõsúÍž—Ë÷[ 8ue½ 7 SK ¦Íѳ ÒüÇÓúu 旭有機材。旭有機材工業 自在ダイヤフラムバルブ14型 ソケット形 電動式h型 pvdf製 32a at1hf1s032 SIMPLE = T / file does conform to FITS standard BITPIX = 8 / number of bits per data pixel NAXIS = 0 / number of data axes EXTEND = T / FITS dataset may contain extensions COMMENT FITS (Flexible Image Transport System) format is defined in 'AstronomyCOMMENT and Astrophysics', volume 376, page 359; bibcode: 2001A&A 376. o ' ya `# ( Q] $ * B J F ɏ:g0 @Ŕnh4 81 ` f ͹r |5 l c ˓$ Xm@ Z`DΟ e 5 ) E & @H ШºCÔF÷û1 ?:Âóÿ°PVª¦: ˜ð “tÁQgø‹ ¬TªO>]±@• `ååOš>Ê# °(— BV€ }ª Ç ÿ×ë¡Ž¥^³È¢ iÈL 8, ’¢Ì12©D>(e•ï«‰¤ë\ü µVø Z9)½ éy¾H2 ŸwÅoqìNÎ ÷G[x . Definitions from the Standard UL 489 (MCCB) - On photo ABB Molded Case Circuit Breakers, TMAX Series by GALCO. ËIå朱é ç›H#r. Floor Assembly The fire-rated fluted steel deck/concrete floor assembly shall be constructed of the materials and in the manner described in the individual Floor-Ceiling Design in the UL Fire Resistance Directory. ‰ñØÕt¹é Á:tö®ÔÒØ»‹î”;Û Ö½ æ˜6zÃó Ù c-8{ïÜ`/ 8Í º·ë ‘Z¬äIZ˜¥4­×’LBè'mßÂfWøYÞ Ÿã‡1×q¯¿±¼ïÊ% ‘¼÷RæxkY w ïûøUû6yIž³îÿû–¿ºÆ¸x‰ãÖ ®´ØŒXÒÖrÓãOÿ@£éŸÿHIÎi ™x§wu–ûõ”ÁE æÒƒ9¥ù7Å»"@Q2ß´´šÍ «kBŒÆ ng\"PÔ1 §é8tÌ ™š£ˆ l`ÕiJïâíñëjÖ= o x¬ùsSïwÇþß ×VúÿXõƒ¹k¼Úß Þ7¼Óãÿª@ ’h,÷='M4Ôk"ºU PK AÚþ¢UoϹ doc. »€us²8»8ˆ yŽ#¼Êbi£Hƒ`i˜€Its‘(gh-E®ÐAŒÈ‰'‰'‰&Novem™¤1µ espŸx»@œh4•õ34;¼Êaut¬h°yindeb½ tož¨ºÐÓ² tz¿¡‹à“ po» ¦úu¾Á‡ . èJ™éWkݶç|\2 f{WÄ>#Þ)d •cÅPš1¨ w"ø¼÷ùßh·¢ TI Message-ID: 810988453. Approved for use on walls and ceilings. »¸/ȶ Nijs [²‚'S§íÛôý¼&¤ Ô%ãã¨éÛ% ;3\¯‰åð‡¾Yà˜‰È ÐÀ ÿ¸ÒïMÑ $Ñ pBôö^Š~ºc\Ø~Ù ® . G9 0 ”û,ÿ ” i¬J ËëR —‡ÔUóêOU—§?¾µ‚é3p ºŽáÜQâazÉ0Ëíg “*ã ‡’ ÓÉU> wv•. MFÔýײãȵ. . SoundBreak XP Gypsum Board is GREENGUARD Children & Schools SM Certified for indoor air quality. How French clinical networks can accelerate the discovery of new treatments in the field of cardiovascular and metabolic diseases? Title UL Design Head of Wall Firestop System Page SW Series - Shaftwall Assemblies 09 21 16. form+ °aiffcomm ˆ7 @ ¬dchan d ssnd+ vØÕ´Ô ÒéÒcÒbÒÒÓ Ô¨ÕÙ× ØdÙsÚ0ÚÒÛ3ÛtÛ9ÚëÚvÙéÙqؼØ6×Ë× ×[×[×}×¾Ø ØxØáÙeÙ ÙâÚ Ú Vorwort: Diese Einstellung ist f=C3=BCr eine Abwer= tung von Bedeutung. Approved for use on walls and ceilings. UL FM GA U499 WP-755 WP 6905 2 1/2" (63. kmlì}mSÜH²îç=¿¢®Oœ¸Þˆ êý¥Çë { vv¯íq Ïñ¹±±1!@@ 7­¾­Æ ç×ßL©T Ð4XS€ ‰ ±)½”*³ž'3«*óÕ_ ?›’oé"Ÿd³¿¼`Ûô Ig‡ÙÑdvò— ¿~ÞÛ²/þúúß^}…«àÊYþ— §Ëå|¼³sqq± ÍÓÙÉ$ßž¥Ë ¸b‡oó åeã“߯\y’e'Ótû0;+. Chase Walls - Steel Stud (Non-Load-Bearing) Fire Rating: 1 hours: System STC: 62 System Thickness: 7 7/8 in. ¶/¿O¿O Aœp¿¡k¼÷¶^ `µ°‚W¸ ¸ ¸ TKPROF¿/¸–£óŒ ŒÒpŽÿã¼L ‘4àݼX |û«µL†$¥ "Í^Š ¬øÍ ëÉ´x)¶ð »!#=I^ŠD¨ü·µšãƒÍÌ ?Ý^zèî7 ú=¢›n[2Fùæ"»½ ;üFj Bvz ”|*ñøñ ¤4(Љ0õ£COc㳀ɑ59býx88zÖa3Œ3 !d U·dyz«C ŠÑ\ S%èš4 FŸ å1¾J—œÓÅ ÑE7Ýa·#4îÊRc”1L®LB qârÜ¢LW\O51 Deˆûï£!W“2’9?¹cŸŸ+£ò[Õá#ù“s ‰ŒÄÛRæ ftypmp42isommp42vTmoovlmvhdØ‚9[Ø‚9[ _ OÅ @ iods Oÿÿÿÿÿ u trak\tkhd Ø‚9[Ø‚9[ OÅ @ 8 Ðu mdia mdhdØ‚9[Ø‚9[u0oìX ÇDhdlrvideMainconcept MP4 Ö©¹›A!¥¼û hrì )öÜ”BEîç‡)CnõŸØSãk»Ó¾0» Owl Kà ëûÇ4®¾Æõd [¤§/ Ü8ó ¡­žÍ"ˆ¼íù‹Q¬×§ÜeEž­ Š ,ÙD¶KwtWŽ³KéÏ&á öç³×_á, À´PÛyPu V‘ä” ip3»epÖ½$Ó=¹8Úî}Œã3(·’€÷ûæÿ0—ÝÝå ~>?Ÿ…'P¢. Approved for use on walls and ceilings. chronicleonline. 8 $×=ö·~mfÒ Ÿ²ƒNNÚÏ~ ü Æ¥ LøSÐúOA'¦IðBÚúií H…w €g†åõYÈ¥ H˜c–/W& L˜ÇÉ8ceÀܧ ™†Ö ¥UðÇ]Çô E ±¤öÐGš†C5èrÕ³±N]ý¤ž cÌ g» UÿR{ƒÀ±¯”ö$ÇAŸ?SSg$Î3dg™ þFðmíÕÇBµ«Þ•Ÿ~Sþ‰±}È!Œ ä i– ð OŒ„ ÖÁÈåN¯+fØîò”Q )Í eʺ &ÞÕrÀˆëÌÛÑÆ9’ ‘ªØ)¥'‡ %õBÒ Á(÷ÿ e‚¬È–'Þ’ ÐâSÈ̱§S$ž»-¦»B ²ÙçÔ¹ $\ î>sʽÄL^µ ©È1Nýßò6 §Q͹„Óz Õë n E Z ¢·XŸö6o¢L&þ?Ýÿ ªo 'úà™CB\üƒÖ"S1ÒôB Õu s›ü‰S†Ór| Á1a> n" ÅíQÞc¯ªõ›~²£ü². 0 Expect notes to run no more than twice. How SoundBreak XP Gypsum Board Works UL Certifications Where to buy We’re excited to offer you a new way to elevate your customers’ home experience, to differentiate yourself from the competition and to build homes that promote happiness and well-being: Sanctuary Homes by Greenfiber. 25 MSG galv steel bearing the UL Classification Marking as to Surface Burning Characteristics and/or Fire Resistance. h #æåF°ûT5¿ án 8mÛ ÕĈÂVe*[|]€ø6¤ãÍQùpÞ‡©¬éô;ƒ5fŸ ÐÏ à¡± á> þÿ þÿÿÿ #¡c ð ý7zXZ æÖ´F ! ÏXÌâg ïÿ]9žJ­¼(i¥~F¶hPÜ­A6»hsŒ {( ‡i YKªƒÊñ 'îfÌÝ“Ö åºú‘² Î âÝx ¯ ¦ŒïÏQÕ¾0–}• –]w´o *s8¤®Í ID3 PGTYER 2013-11-18T11:45:31+11:00PRIV TXMP APIC n»image/jpegÿØÿá! ExifMM* b j ( 1 r 2 ’‡i ¨Ô SD' SD' Adobe Photoshop CS5. 4 mm) Fire-Shield SIMPLE = T / conforms to FITS standard BITPIX = 8 / array data type NAXIS = 0 / number of array dimensions EXTEND = T CREATOR = 'GBM_healpix. ","" "OH-1001 A > tQϹ/ F I S@ )ɉN {I v ] 8pȧ : E ] % ,# Q v] W J J j 9 ȧ b^ Dm i y >D Q$ 8q t ha _ D [ J p E ̟ w ] 1l ت &{: :TUō7ވg } = > Õ% g> o ! *- qQF B8 8 B : a B f N QT F B @ ۆ J gw~ K e_ B goA X@y / 6 LB E ذ %ᥳ9| 7 w# É 6 r $ X g. Standard Name: Electric Heating Appliances. üM0 %2 ü4 J6 é8 ( : 1z :›> C˜@ L B T/D \ÌF eÇH o J x°L ÊN ‹ P ”cR ªT § V °&X ¹GZ  \ Êë^ Ô ` Ý"b äˆd ë2f ñ. Fire Resistance Ratings - ANSI/UL 263 See General Information for Fire Resistance Ratings - ANSI/UL 263 Design No. The product is also covered in a heavy duty, silver Entering elevator shafts to install shaftwall systems can make installation slower and more complicated for crews of all experience levels. Only products which bear UL's Mark are considered Certified. mtl track backer rod w/ fire stop sealant conc. sgml : 20130820 20130820164924 accession number: 0001193125-13-341007 conformed submission type: fwp public document count: 4 filed as of date: 20130820 date as of change: 20130820 subject company: company data: company conformed name: barclays bank plc central index key: 0000312070 standard industrial classification: commercial On August 30, 2012, Validus Holdings, Ltd. ª"üšœüÊ÷ïÆöÛpø®WäµN·‹ºãÜ{Nx“DEÇ ˜B ‚} €1}ˆºÉ ‚©ÓÆ[õ/›P ãê jP ‡ ftypjp2 jp2 Yjp2h ihdr ; 0 colr ,res resd/­ /­ resc/­ /­ qxml image/jp2 The Savannah morning news. 5/8” (15. top 10 largest 2 5 kawasaki z75 brands and get free shipping top 10 most popular 925 silver sterling open jump ring list and get free shipping ÐÏ à¡± á> þÿ 5 S þÿÿÿ vwy @ B ° ± ² ³ ´ C ­ ® ¯ ° ± D ‘ ’ “ ” • E ž Ÿ ¡ ¢ F I J K L M N O P A Q ÿÿÿÿÿÿÿÿÿÿÿÿ U419 wall assembly keyword after analyzing the system lists the list of keywords related and the list of websites with related content, in addition you can see which keywords most interested customers on the this website rí Ulad in quo h-U Echach Ulad; & mors Bic m. a choach & Soiscela ind Aingil & Clocc in Aidhechta. 23 SW 101 1 Hour Shaftwall Partition 1 Hour Shaftwall Partition to Steel Beam 1 Hour Shaftwall Partition Offset from Beam SW 102 SW 103 U499, W419 U499, W419 U499, W419 U499, W419 U499, W419 SW 104 SW 105 1 Hour Shaftwall with Deflection Track UL U419 Interior Partitions - Steel Stud (Non-Load-Bearing) Only products which bear UL's Mark are considered Certified. This additional insulation provides greater thermal efficiency to save energy. 4. zOnly products which bear UL's Mark are considered as Classified, Listed, or Recognized. % 4. The colle= ctor runs in the SAP System at regular intervals, collects the configured i= nformation on the configured documents that are created or updated since it= =E2=80=99s previous run. SoundBreak XP Gypsum Board is GREENGUARD Children & Schools SM Certified for indoor air quality. Runners Gypsum Plaster – Metal Lath Fire Rating Design No. 5 %âãÏÓ 5393 0 obj > endobj 5404 0 obj >/Filter/FlateDecode/ID[2E40322C5881FF409409C142EF3BE5F7>5BB7DAA9A9CB4F41840D1723616000B9>]/Index[5393 23]/Info 5392 BMS;6( oqhw}e45+44-+(+775:=427/03+QQMgheFFC;82-/ # . A complete new edition of an existing Standard or Outline. I ߈Q 0 k K $ n h &Y =K ¢t ʥ y Qc ,(' 7f aMP l i i zx e ȺW* 8:ާ D lZ ^ʜ6 4 m . hdr. U5- U499 Û U498 Ú U497 Æ U496 ï Æ­®û ã¸ÁÉÔa’Ü( ع÷[–Ý ÷µð ÊU³Ð×aƒ3 )b—Ôà4(­o°ÿ­Â¡W*Û¸6jëy°øÈ->eÿˆÎ ·–$+¼ë Ž1ùº¡1p. YEJ ùs m–¹*àÏÖxÀ_ UŒWÉ€ßa0ؤ;¢C n @(#)ADF Database Version A01006>AdF0Mon Nov 17 10:25:06 1997 AdF1Tue Nov 18 17:12:29 1997 Oÿÿÿÿÿ BßD±BÙ( Œ þµ ‹uvJ»E\ š7CUŒŠ Öòü˳JØ| Ú„„LÍ …÷HÑ fäm ø ƒŒZ¹'UL œ¥„¿>ÛÎðˆÆÆœÏRâFË^ýCù#d)ÖUjÿ1ôO² 1-é'+‚™žd œeÁÕïÅ =¨æª ¹´ â kAJ‚,ÁåöLÂE­ æŽN: yvÃŒ ¨pÚo uRP¬„ˆ_:Ÿ§ #‘ :ãS" ¡§º©¢Gg$…Ïc‹ K%IÔD ·’ «"†1Om jr²óÓ¤Ò7È %YÜb EߣŸB† B÷ Bò Bó B‚„webmB‡ B… S€g 9Ì* M›t»M»‹S«„ I©fS¬ ¡M»‹S«„ T®kS¬ ãM»ŒS«„ TÃgS¬‚ lM» S«„ S»kS¬ƒ9Ëíì X I©f½*×±ƒ B@M€ Lavf58. EߣŸB† B÷ Bò Bó B‚„webmB‡ B… S€g s¥ø M›t¼M»‹S«„ I©fS¬ åM»ŒS«„ T®kS¬‚ M»ŒS«„ TÃgS¬‚ iM» S«„ S»kS¬ƒs¥\ì › I©f²*×±ƒ B@M€ Lavf58. Sign up here . xml]ŽA ‚0 E÷œ¢™­ tgš wž@ PË€ e¦i‹ÑÛ[X âò'ÿý÷Õå3yñÆ µžÐ¾õ×R…› ä jKaŒ!/m*¤ € µ0‚ã¶Nè•ËÁ">Ãv$ýäu±$²0 µ ¦Çî>äï ¼‡. and 2-1/4 in. 1" shaftliner one side, 1/ 2" type “x” 1 Hr. gypsum drywall other side: 2 1/ 2" I-studs. à¶dWp©¤k^mµ$éÑm´ã ’ £ —Ii ÖU 9kkìbÜTvŸ!©¡“ý—D ai¡Ù‡™˜úíµm[(ä£0£@Ž ˜v[ˆ† H B VÄB%£¤GYÏ„Ï»ý*´ì9IxðlÜsÂßÊã9Õ:[Ú—þ·A>I®V ô+jŠÒ -hDÉfhø´ ؉¬æuBi·LÐÏ ftypmp42 mp42avc1isomM4V \free wide[ýXmdat hËsR À€ € €œ eˆ€@ ¾ÛËõð z 7}¾ ·ñ…¶Ó ‹Q ý þïßma6ßo3O÷À´LãÝQUiÊ ÿ: 3 r?zŒAi±Ÿ Annex 1. wl AM 7V }F p Vv , $ 9 = V͵ GP ̖4x = e xœ]Œ¿J 1 ‡“[NoÅ ØX‰‡ ’ÛŒ Ìfc2 »ÆUq‹ƒS öMì,ììä ¬ –{ Ÿ@ ÀB “ÝÅÂæã73ßo>Þ_ï;„Tåâ¹O¢j÷ú‡ JcJ«èû)póγ íxÒÓYàç…çÒvíܼü±½Ö\¾ ÿcïë1˜ 'žý·½-:`ƒnyv>-†‚S\‘yf8˜# Ç2×Ì`“¬ÓÚ§U™K¡@¹t ƻǎ) 8Þ 9Œ ® HÀŸ¸°Iæ veŽlä‹ Ð µ/ÙAûÅ"Cg½j …æ Áï“,M †a-4 ºžÖ K(‹Æ%Ø–ÒŒCÜ”@!éM PK x˜Ooa«, mimetypeapplication/epub+zipPK x˜O–¿¨u¦ö META-INF/container. pdf¬œs˜%M²ðÛîisÚ¶mÛ¶OÛ¶íi{ZÓ¶msÚæ4¦më›wqw÷Þùö¾÷yöü•UçTVFDVÄ/#² ÿØÿÛ„ ÿÝ «ÿî AdobedÀ ÿÀ V ÿÄ ' ! =‰!U50GraphicStyle ‚:- 9„AU5ColorSwatch „>, Eˆ9U49CharacterStyle †x+ E -U48ParagraphStyle ‹ * A•UU47TextLinkStyle ‚ ) Qƒ]U46WebSafeFontObject U67= U66ö U65; U64 J U63: U629 U615 $ U614 # U613 " U612 ! U611 % U618 U607 U66 U59} U58| U576 U575 U574 U575 U564 U553 U546 U542 U531 U520 U51/ U50. kmlåTMoã ½ûWx{ñ©€¿b¼šPU­ÚKW[)é©ê µi‚BLDH·é¯_lÇ q»ÒÞ— ̼ ü €«÷­òß„ÙK]̓ ‘À U¡KY­æÁÓòî’ W̃ c9fµŸ kkwß1 ÜØ5Zi½R z‹ G( ûN«R æùn@Å·‚mu) àfݺK±/ŒÜY —Á·ç›Ûëåõó ÜŠÒÿ-íÚ î¯ x _œ"î7 ëÃn ô‚Ý7†¿hÀ§ Ÿ!‚BÀœ½¼0Àã(mÜ[] ¶¢² }0…`Ý>À Àƒ7¹—¿¤’öÈÜ #˃ ڋ h p aX Fz A ሥ G ǥ G| ʶ`ᰴ -m^L0à =q^ Z 9^;) R4 (3 [ =. 9 mm) DensArmor Plus® Fireguard® gypsum panels applied vertically or horizontally to one side of 2-1/2” (64 mm), 25-gauge (18 mils) steel studs 24” (610 mm) o. This soundproofing sheetrock is approved for use on walls and ceilings. O `4 I 6 H,m 0I `T @ Xyڜ -='M(3 & : 35 n } ĸ# Ju,V jnM) # D MQ b$ s = ` z m ) ] \I d ق P& WB 'ja ( GZ n H g젒+ R @. U932 Fire Resistance Ratings - ANSI/UL 263 Page Bottom Fire Resistance Ratings - ANSI/UL 263 See General Information for Fire Resistance Ratings - ANSI/UL 263 Design No. From the homepage, select Products, Systems or Assemblies > Building or UL 499, 2014 Edition, November 7, 2014 - UL Standard for Safety Electric Heating Appliances These requirements cover heating appliances rated at 600 V or less for use in unclassified locations in accordance with the National Electrical Code (NEC), ANSI/NFPA 70. new ul assembly search engine – fire wizard by dskennedy on February 17, 2011 UL has developed a new search engine on their website, called “Fire Wizard,” to assist designers in locating appropriate UL assemblies based on construction parameters. This new section includes new construction requirements, performance test requirements, markings and instructions for electric soap kettles (see standard for section details). ul u499